PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00042992001
Common NameGSBRNA2T00042992001, LOC106346932
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 347aa    MW: 37911.2 Da    PI: 6.6682
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00042992001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702226.54.9e-701152742154
               DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrel....ks 80 
                          r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrerq+qla + +k++++a       +    +r+ ++      
  GSBRNA2T00042992001 115 RQGSMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERQAQLAGLPTKRSREAssgggddD---DEREGDEngaqGG 201
                          7899****************************************************999888887766775432...2222222333345 PP

               DUF702  81 kkqsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                             sal++ ++++a+s+  +e s+lP+e+s +avfrc+rvss+dd++ee+aYqtav+igGhvfkGiLydqG+++
  GSBRNA2T00042992001 202 GGGSALACIRVVNASSS-GFESSHLPPELSLPAVFRCMRVSSIDDEDEEYAYQTAVNIGGHVFKGILYDQGPSD 274
                          66789999999999765.99***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-63118273IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-27120162IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016249.9E-26224272IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MAGLFYLGGR ENNKQDHHHQ DKDHNEDRSN NYLHLYKDEI YNNNKGFEIW PPQYFQQQQE  60
QQNHVAPPTN FYSFGMVPSG SSHNNNRSSN RSLYFNVVSD HEPVRSSTGR FTVTRQGSMN  120
CQDCGNQAKK DCPHMRCRTC CKSRGFDCQT HVKSTWVPAA KRRERQAQLA GLPTKRSREA  180
SSGGGDDDDE REGDENGAQG GGGGSALACI RVVNASSSGF ESSHLPPELS LPAVFRCMRV  240
SSIDDEDEEY AYQTAVNIGG HVFKGILYDQ GPSDDHRYSS SPAAIAAETS QHHLNLLAST  300
SSVATTTGVT ASNINNASID PSSVYTAAPI NSFVTAATSF FASPRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00042992001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052680.0GU205268.1 Brassica rapa subsp. pekinensis short internode related sequence 7 (SRS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013641856.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
RefseqXP_013641857.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
RefseqXP_013641858.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
SwissprotQ9FXH70.0SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLA0A078GW490.0A0A078GW49_BRANA; BnaA06g13970D protein
STRINGBra025768.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-152SHI-related sequence 7
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]